Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

HOXA5 Rabbit Polyclonal Antibody

SKU: orb329606

Description

HOXA5 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of HOXA5. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human HOXA5. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Porcine, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HOXA5
TargetHOXA5
Protein SequenceSynthetic peptide located within the following region: VGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGG
Molecular Weight29kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti HOX1 antibody, anti HOX1.3 antibody, anti HOX1C antibody, anti MGC9376 antibody

Similar Products

  • HOXA5 Rabbit Polyclonal Antibody [orb330051]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • HoxA5 rabbit pAb Antibody [orb768635]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • HOXA5 Antibody [orb48329]

    ELISA,  IHC,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • HOXA5 Rabbit Polyclonal Antibody (Biotin) [orb446947]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    Biotin

  • HOXA5 Antibody [orb1319961]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

HOXA5 Rabbit Polyclonal Antibody

Human kidney

HOXA5 Rabbit Polyclonal Antibody

Sample Type: Mouse dorsal skin -5d postnatal, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Brown: HOXA5, Gene Name: HOXA5.

HOXA5 Rabbit Polyclonal Antibody

WB Suggested Anti-HOXA5 Antibody Titration: 0.2-1 ug/mL, Positive Control: 721_B cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_061975

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

HOXA5 Rabbit Polyclonal Antibody (orb329606)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry