You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IF, IHC-Fr, IHC-P, WB |
|---|---|
| Dilution Range | WB:1:500-1:2,000, IF:1:500-1:2,000, IHC-P:1:500-1:2,000, IHC-F:1:500-1:2,000 |
| Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
| Application Notes |
Key Properties
−| Host | Goat |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 85 to 200 aa of human HTT produced in E. coli. Antigen Sequence: PLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAEL |
| Target | Huntingtin |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Form/Appearance | Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum. |
| Concentration | 1 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Huntingtin/HTT Rabbit Polyclonal Antibody [orb1819351]
ELISA, IHC
Human
Rabbit
Polyclonal
Unconjugated
Mouse Huntingtin (HTT) ELISA Kit [orb780154]
Mouse
0.16-10 ng/mL
0.061 ng/mL
Rat Huntingtin (HTT) ELISA Kit [orb780155]
Rat
0.16-10 ng/mL
0.053 ng/mL
Rat Serotonin Transporter (SERT) ELISA Kit [orb780175]
Rat
31.25-2000 pg/mL
12.7 pg/mL
Mouse Serotonin Transporter (SERT) ELISA Kit [orb780254]
Mouse
31.25-2000 pg/mL
12.4 pg/mL

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Immunohistochemical analysis of Rat LV using Huntingtin antibody.
Quick Database Links
Documents Download
Request a Document
Protocol Information
HTT Antibody (orb153341)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



