Human CA8 protein

SKU: orb594896

Description

This Human CA8 protein spans the amino acid sequence from region 2-290aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Cancer Biology

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The esterase activity is determined to be is 162.5 pmol/min/μg.
• Tag: C-terminal 6xHis-tagged
• Expression Region: 2-290aa
• Protein Length: Partial
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.
• MW: 34.04 kDa
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid
• Buffer/Preservatives: 0.2 μm filtered 20 mM Tris-HCl, 500 mM NaCl, 1 mM DTT, pH 8.5
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Carbonic Anhydrase-Related Protein; CARP; Carbonic Anhydrase VIII; CA-VIII; CA8; CALS

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P35219