Human CD47 protein

SKU: orb594874

Description

This Human CD47 protein spans the amino acid sequence from region 19-139aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation; Cell Biology

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Loaded Anti-Human CD47 mAb-Fc on Protein A Biosensor, can bind Human CD47-His with an affinity constant of 0.22 nM as determined in BLI assay.
• Tag: C-terminal 6xHis-tagged
• Expression Region: 19-139aa
• Protein Length: Partial
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.
• MW: 14.76 kDa
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 10 mM Tris-Citrate, 150 mM NaCl, pH 8.0
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

Q08722