Human CD86 protein

SKU: orb594870

Description

This Human CD86 protein spans the amino acid sequence from region 24-247aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

• Application Notes:
  Extracellular Domain

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CTLA-4-Fc-Avi at 5μg/ml can bind Human B7-2-His, the ED50 of Recombinant Human B7-2-His is 1.19 μg/ml.
• Tag: C-terminal 6xHis-tagged
• Expression Region: 24-247aa
• Protein Length: Extracellular Domain
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.
• MW: 26.69 kDa
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

T-Lymphocyte Activation Antigen CD86; Activation B7-2 Antigen; B70; BU63; CTLA-4 Counter-Receptor B7.2; FUN-1; CD86; CD28LG2

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

AAH40261.1