You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by C3H10T1/2(CCL-226) cells is 15-45 μg/ml. |
| Tag | Tag-Free |
| Expression Region | 24-198aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 19.9 kDa |
| Purity | > 96% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | II+GPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 10mM PB, pH 6.0, 300mM NaCl |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−RecombinantShh,Mouse(CHO-expressed) [orb1494667]
> 95% as analyzed by SDS-PAGE and HPLC.
20 kDa, observed by non-reducing SDS-PAGE.
CHO
RecombinantIHH,Human [orb1494835]
> 95% as analyzed by SDS-PAGE.
20 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
RecombinantDHH,Human [orb1494898]
> 95% by SDS-PAGE and HPLC analyses.
~20 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
Recombinant Human Sonic HedgeHog (Shh) [orb1494940]
>98% by SDS-PAGE and HPLC analyses.
Approximately 20.0 kDa, a single non-glycosylated polypeptide chain containing 176 amino acids.
Escherichia coli
Recombinant Human Desert hedgehog protein(DHH) (Active) [orb1650733]
>96% as determined by SDS-PAGE and HPLC.
19.9 kDa

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SDS-PAGE analysis of Human DHH protein (Active)
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human DHH protein (Active) (orb359261)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review