Human FGF8 protein

SKU: orb594757

Description

This Human FGF8 protein spans the amino acid sequence from region 23-215aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Application Notes:
  Partial of Isoform 3

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 21.87 ng/ml.
• Tag: Tag-Free
• Expression Region: 23-215aa
• Protein Length: Full Length of Mature Protein of Isoform FGF-8B
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.
• MW: 22.5 kDa
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Fibroblast growth factor 8;Androgen-induced growth factor;Heparin-binding growth factor 8;AIGF;HBGF-8;FGF-8B

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P55075, P37237