You have no items in your shopping cart.
Description
Research Area
Infectious Disease & Virology
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The specific activity determined by an anti-viral assay is no less than 1.0 x 10 ^ 8 IU/mg. |
| Tag | Tag-Free |
| Expression Region | 24-189aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 19.5 kDa |
| Purity | > 97% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | M+CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4, containing 3 % Mannitol, 5 % Trehalose, 0.05 % Tween-80 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−IFN-alpha-1/13, LeIF D
Similar Products
−Human IFNA1 protein (Active) [orb359209]
> 96% as determined by SDS-PAGE and HPLC.
19.5 kDa
E.Coli
Recombinant Human Interferon alpha-1/13 protein(IFNA1) (Active) [orb1650693]
>97% as determined by SDS-PAGE and HPLC.
19.5 kDa
Recombinant Human Interferon alpha-1/13 protein(IFNA1) (Active) [orb1650694]
>96% as determined by SDS-PAGE and HPLC.
19.5 kDa

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SDS-PAGE gel analysis of orb359208.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Human IFNA1 protein (Active) (orb359208)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
