You have no items in your shopping cart.
Description
Research Area
Immunology & Inflammation
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The specific activity is determined by its binding ability in a functional ELISA. Immobilized rHuIL-36γ at 1 µg/mL can bind recombinant human IL-1 Rrp2 Fc Chimera with a range of 0.15-5 µg/mL. |
| Tag | Tag-Free |
| Expression Region | 1-169aa |
| Protein Length | Full Length |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 18.7 kDa |
| Purity | > 95% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−IL-1-related protein 2, Interleukin-1 epsilon, IL-1 epsilon, Interleukin-1 family member 9, IL-1F9
Similar Products
−Human IL36G protein (Active) [orb358995]
> 95% as determined by SDS-PAGE and HPLC.
17.0 kDa
E.Coli
Recombinant Human Interleukin-36 gamma protein(IL36G) (Active) [orb1650631]
>95% as determined by SDS-PAGE and HPLC.
18.7 kDa
Recombinant Human Interleukin-36 gamma protein(IL36G) (Active) [orb1650630]
>95% as determined by SDS-PAGE and HPLC.
17.0 kDa

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

SDS-PAGE gel analysis of orb358994.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Human IL36G protein (Active) (orb358994)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
