Human KLRK1 protein

SKU: orb605229

Description

This Human KLRK1 protein spans the amino acid sequence from region 78-216aa. Purity: Greater than 93% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human ULBP1, the EC50 of human KLRK1 protein is 222.4-276.0 ng/ml.
• Tag: C-terminal hFc1-tagged
• Expression Region: 78-216aa
• Protein Length: Partial
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.
• MW: 43.6 kDa
• Purity: Greater than 93% as determined by SDS-PAGE.
• Protein Sequence: FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Killer cell lectin-like receptor subfamily K member 1 (NK cell receptor D) (NKG2-D-activating NK receptor) (CD314)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human ULBP1, the EC50 of human KLRK1 protein is 222.4-276.0 ng/ml.

Human KLRK1 protein Fc tag captured on COOH chip can bind Human ULBP1 protein Fc/myc tag with an affinity constant of 2.27 nM as detected by LSPR Assay.

Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human Biotinylated ULBP1, the EC50 is 4.254-7.295 ng/ml.

The purity of KLRK1 was greater than 90% as determined by SEC-HPLC.

Quick Database Links

UniProt

P26718