Human MIF protein

SKU: orb605235

Description

This Human MIF protein spans the amino acid sequence from region 2-115aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

• Application Notes:
  Full Length of Mature Protein

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized MIF at 2 μg/ml can bind Anti- MIF Rabbit Monoclonal Antibody, the EC50 is 49.61-69.45 ng/ml.
• Tag: C-terminal hFc1-tagged
• Expression Region: 2-115aa
• Protein Length: Full Length of Mature Protein
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.
• MW: 41.3 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

(MIF)(Glycosylation-inhibiting factor)(GIF)(L-dopachrome isomerase)(L-dopachrome tautomerase)(Phenylpyruvate tautomerase)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized MIF at 2 μg/ml can bind Anti- MIF Rabbit Monoclonal Antibody, the EC50 is 49.61-69.45 ng/ml.

Quick Database Links

UniProt

P14174