Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

IGF2BP1 Rabbit Polyclonal Antibody

SKU: orb330971

Description

IGF2BP1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of IGF2BP1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human IGF2BP1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human IGF2BP1
TargetIGF2BP1
Protein SequenceSynthetic peptide located within the following region: AFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPP
Molecular Weight63 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CRD-BP antibody, anti CRDBP antibody, anti IMP-1 antibody, anti IMP1 antibody, anti VICKZ1 antibody, anti ZBP1 antibody

Similar Products

  • IGF2BP1 Rabbit Polyclonal Antibody [orb330140]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • IGF2BP1 Rabbit Polyclonal Antibody [orb1518]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • IGF2BP1 Antibody [orb522420]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • IGF2BP1 Rabbit Polyclonal Antibody [orb378121]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • IMPI/IGF2BP1 Rabbit Polyclonal Antibody [orb865415]

    ELISA,  FC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

IGF2BP1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Protein may be phosphorylated.

IGF2BP1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

IGF2BP1 Rabbit Polyclonal Antibody

Sample Tissue: Human 721_B, Antibody dilution: 1.0 ug/ml.

IGF2BP1 Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

IGF2BP1 Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml.

IGF2BP1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

IGF2BP1 Rabbit Polyclonal Antibody

Positive control (+): 293T (2T), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

IGF2BP1 Rabbit Polyclonal Antibody

Application: IHC, Species+tissue/cell type: Human small intestine, Primary antibody dilution: 1:300, Secondary antibody: Anti-rabbit-linker, Fbex-HRP.

IGF2BP1 Rabbit Polyclonal Antibody

Sample Type: Human lung carcinoma, Primary Antibody dilution: 1:300, Secondary Antibody: Anti-rabbit-linker, Fbex-HRP, Secondary Antibody dilution: NOT FOUND, Color/Signal Descriptions: Brown: IGFBP1 Blue: Nuclei, Gene Name: IGF2BP1.

IGF2BP1 Rabbit Polyclonal Antibody

WB Suggested Anti-IGF2BP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006537

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

IGF2BP1 Rabbit Polyclonal Antibody (orb330971)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry