Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

IKBKB Rabbit Polyclonal Antibody

SKU: orb329679

Description

IKBKB Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of IKBKB. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human IKBKB. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human IKBKB
TargetIKBKB
Protein SequenceSynthetic peptide located within the following region: CITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNN
Molecular Weight86kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti FLJ40509 antibody, anti IKK-beta antibody, anti IKK2 antibody, anti IKKB antibody, anti MGC131801 antibody, anti NFKBIKB antibody

Similar Products

  • Phospho-IKK beta (Tyr188) Rabbit Polyclonal Antibody [orb5517]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Phospho-IKK beta (Tyr199) Rabbit Polyclonal Antibody [orb5519]

    IF,  IHC-Fr,  IHC-P

    Canine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • IKK beta/IKBKB Rabbit Polyclonal Antibody [orb215975]

    FC,  ICC,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • IKK beta Rabbit Polyclonal Antibody [orb157676]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Phospho-IKK beta (Ser466) Rabbit Polyclonal Antibody [orb5518]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

IKBKB Rabbit Polyclonal Antibody

Sample Type: Human 721_B, Antibody Dilution: 1.0 ug/mL, IKBKB is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

IKBKB Rabbit Polyclonal Antibody

Application: Western blotting Species+tissue/cell type: Lane 1: 100 ug mouse liver lysate, Lane 2: 100 ug mouse brain lysate, Lane 3: 100 ug mouse heart lysate, Lane 4: 100 ug mouse kidney lysate, Lane 5: 100 ug mouse lung lysate, Lane 6: 100 ug mouse thymus lysate, Lane 7: 100 ug mouse spleen lysate, Lane 8: 100 ug mouse testis lysate, Lane 9: 100 ug HeLa cell lysate, Primary antibody Dilution: 1:1000, Secondary antibody:Anti-rabbit-AP, Secondary antibody Dilution: 1:10000.

IKBKB Rabbit Polyclonal Antibody

Sample Type: Primary vascular endothelial cells. Protocol: Loaded 30 ug of cell lysate of each. One normal, one cultured with high glucose (which enhances IKK Beta). Expected band is cut. 10% Gel concentration.Primary Dilution: 1:1000.

IKBKB Rabbit Polyclonal Antibody

WB Suggested Anti-IKBKB Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human brain.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001547

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

IKBKB Rabbit Polyclonal Antibody (orb329679)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry