Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ILF2 Rabbit Polyclonal Antibody

SKU: orb575598

Description

ILF2 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of ILF2. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human ILF2. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Immunology & Inflammation, Molecular Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ILF2
TargetILF2
Protein SequenceSynthetic peptide located within the following region: HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEEEE
Molecular Weight43 kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

NF45, PRO3063

Similar Products

  • NF45/ILF2 Rabbit Polyclonal Antibody [orb1819467]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • ILF2 Rabbit Polyclonal Antibody [orb395357]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • ILF2 Rabbit Polyclonal Antibody [orb395358]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • ILF2 rabbit pAb Antibody [orb774791]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • ILF2 Antibody [orb241897]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

ILF2 Rabbit Polyclonal Antibody

Sample Type: MCF-7 WT a whole cell lysates (110 UG), Primary dilution: 1.5 mg/mL, Secondary Antibody: LI-COR Donkey anti-rabbit, Secondary dilution: 1:10000, ILF2 is supported by BioGPS gene expression data to be expressed in MCF7.

ILF2 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation and phosphorylation.

ILF2 Rabbit Polyclonal Antibody

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

ILF2 Rabbit Polyclonal Antibody

Human kidney

ILF2 Rabbit Polyclonal Antibody

Rabbit Anti-ILF2 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

ILF2 Rabbit Polyclonal Antibody

WB Suggested Anti-ILF2 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004506

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

ILF2 Rabbit Polyclonal Antibody (orb575598)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry