Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

IRF1 Rabbit Polyclonal Antibody

SKU: orb573758

Description

IRF1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of IRF1. It is suitable for IHC-P, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human IRF1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Infectious Disease & Virology

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human IRF1
TargetIRF1
Protein SequenceSynthetic peptide located within the following region: RMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPD
Molecular Weight36kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

MAR, IRF-1

Similar Products

  • IRF1 Rabbit Polyclonal Antibody [orb623806]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • IRF1 Rabbit Polyclonal Antibody [orb576535]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • IRF-1 rabbit pAb Antibody [orb767257]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • IRF1 Rabbit Polyclonal Antibody [orb10932]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Porcine, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • IRF1 Antibody [orb522616]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

IRF1 Rabbit Polyclonal Antibody

IRF1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb573758 with 1:200 dilution. Western blot was performed using orb573758 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: IRF1 IP with orb573758 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

IRF1 Rabbit Polyclonal Antibody

Rabbit Anti-IRF1 Antibody, Catalog Number: orb573758, Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue, Observed Staining: Nucleus, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

IRF1 Rabbit Polyclonal Antibody

Rabbit Anti-IRF1 Antibody, Catalog Number: orb573758, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

IRF1 Rabbit Polyclonal Antibody

WB Suggested Anti-IRF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002189

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

IRF1 Rabbit Polyclonal Antibody (orb573758)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry