Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ISG15 Rabbit Polyclonal Antibody

SKU: orb584319

Description

ISG15 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ISG15. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human ISG15. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Porcine, Rabbit, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Infectious Disease & Virology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Porcine, Rabbit, Sheep

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ISG15
TargetISG15
Protein SequenceSynthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK
Molecular Weight17kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

G1P2, IP17, UCRP, IFI15, IMD38, hUCRP

Similar Products

  • ISG15 Rabbit Polyclonal Antibody [orb381901]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • ISG15 Antibody [orb1261136]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • HERC5 Antibody [orb422774]

    ELISA,  IF,  IHC

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • USP18 Antibody [orb53935]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • ISG15 rabbit pAb Antibody [orb773893]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

ISG15 Rabbit Polyclonal Antibody

WB analysis of orb584319.

ISG15 Rabbit Polyclonal Antibody

Sample Type: 1. Human NT-2 cells (60 ug), 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.

ISG15 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

ISG15 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

ISG15 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

ISG15 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

ISG15 Rabbit Polyclonal Antibody

Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. ISG15 is supported by BioGPS gene expression data to be expressed in HeLa.

ISG15 Rabbit Polyclonal Antibody

Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. ISG15 is supported by BioGPS gene expression data to be expressed in MCF7.

ISG15 Rabbit Polyclonal Antibody

Application: IHC, Species+tissue/cell type: Mouse brain stem cells, Primary antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.

ISG15 Rabbit Polyclonal Antibody

WB Suggested Anti-ISG15 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human kidney.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005092

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

ISG15 Rabbit Polyclonal Antibody (orb584319)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry