KIAA1267 Rabbit Polyclonal Antibody

SKU: orb325972

Description

KIAA1267 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting KANSL1. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: KANSL1
• Protein Sequence: Synthetic peptide located within the following region: QPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLN
• Molecular Weight: 121kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DKFZp686P06109 antibody, anti DKFZp727C091 antibody, anti MGC102843 antibody, anti NSL1 antibody, anti MSL1v1 antibody, anti CENP-36 antibody, anti KIAA1267 antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-KIAA1267 Antibody, Titration: 1.0 ug/mL, Positive Control: ACHN Whole Cell.

Quick Database Links

Gene Symbol

KANSL1

UniProt

Q7Z3B3

RefSeq (Protein):NP_056258