Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

KCNAB2 Rabbit Polyclonal Antibody

SKU: orb324606

Description

KCNAB2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of KCNAB2. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human KCNAB2
TargetKCNAB2
Protein SequenceSynthetic peptide located within the following region: SSVLLGASNADQLMENIGAIQVLPKLSSSIIHEIDSILGNKPYSKKDYRS
Molecular Weight39kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti AKR6A5 antibody, anti HKvbeta2 antibody, anti HKvbeta2.1 antibody, anti HKvbeta2.2 antibody, anti KCNA2B antibody, anti KV-BETA-2 antibody, anti MGC117289 antibody

Similar Products

  • KCNAB2 Rabbit Polyclonal Antibody [orb324736]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • KCNAB2 Rabbit Polyclonal Antibody [orb324737]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • KCNAB2 Rabbit Polyclonal Antibody [orb324607]

    WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • KCNAB2 Antibody [orb1242728]

    ELISA,  IHC,  WB

    Canine, Human, Mouse, Rat, Zebrafish

    Rabbit

    Polyclonal

    Unconjugated

  • KCNAB2 Rabbit Polyclonal Antibody [orb324608]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

KCNAB2 Rabbit Polyclonal Antibody

WB Suggested Anti-KCNAB2 antibody Titration: 1 ug/mL, Sample Type: Human HepG2.

KCNAB2 Rabbit Polyclonal Antibody

Rabbit Anti-KCNAB2 Antibody, Catalog Number: orb324606, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec, Protocol located in Reviews and Data.

KCNAB2 Rabbit Polyclonal Antibody

WB Suggested Anti-KCNAB2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:2500, Positive Control: Jurkat cell lysate, KCNAB2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_742128

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

KCNAB2 Rabbit Polyclonal Antibody (orb324606)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry