Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

KCNK3 Rabbit Polyclonal Antibody

SKU: orb329807

Description

KCNK3 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of KCNK3. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human KCNK3. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Guinea pig, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Guinea pig, Rabbit, Rat, Sheep

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human KCNK3
TargetKCNK3
Protein SequenceSynthetic peptide located within the following region: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL
Molecular Weight43kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti TASK antibody, anti TBAK1 antibody, anti K2p3.1 antibody, anti TASK-1 antibody

Similar Products

  • TASK-1 rabbit pAb Antibody [orb771246]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • KCNK3 Antibody [orb416827]

    ELISA,  IF,  IHC

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • KCNK3 Rabbit Polyclonal Antibody [orb100936]

    WB

    Bovine, Canine, Gallus, Human, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Kcnk3 Antibody [orb525170]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • KCNK3 Antibody [orb676253]

    ELISA,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

KCNK3 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/mL.

KCNK3 Rabbit Polyclonal Antibody

Positive control (+): Hela (HL), Negative control (-): Liver tumor (T-LI), Antibody concentration: 3 ug/mL.

KCNK3 Rabbit Polyclonal Antibody

WB Suggested Anti-KCNK3 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002237

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

KCNK3 Rabbit Polyclonal Antibody (orb329807)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry