Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

KLB Rabbit Polyclonal Antibody

SKU: orb325853

Description

KLB Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of KLB. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human KLB. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human KLB
TargetKLB
Protein SequenceSynthetic peptide located within the following region: DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG
Molecular Weight120 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti BKL antibody, anti MGC142213 antibody

Similar Products

  • KLB Antibody [orb422928]

    ELISA,  IF,  IHC

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • KLB Rabbit Polyclonal Antibody (PE) [orb499177]

    ICC,  IF

    Human, Mouse, Rat, Sheep

    Rabbit

    Polyclonal

    PE

  • KLB/Beta Klotho Antibody [orb1536091]

    IHC,  IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • KLB/Beta Klotho Antibody [orb1538088]

    IHC,  IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • KLB Rabbit Polyclonal Antibody (FITC) [orb188811]

    ICC,  IF

    Human, Mouse, Rat, Sheep

    Rabbit

    Polyclonal

    FITC

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

KLB Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

KLB Rabbit Polyclonal Antibody

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.

KLB Rabbit Polyclonal Antibody

Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/mL.

KLB Rabbit Polyclonal Antibody

Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 0.5 ug/mL.

KLB Rabbit Polyclonal Antibody

Human Testis

KLB Rabbit Polyclonal Antibody

Immunohistochemistry of formalin-fixed, paraffin-embedded human colon tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/mL.

KLB Rabbit Polyclonal Antibody

Immunohistochemistry of formalin-fixed, paraffin-embedded human testis tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/mL.

KLB Rabbit Polyclonal Antibody

WB Suggested Anti-KLB Antibody Titration: 1 ug/mL, Positive Control: 721_B cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_783864

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

KLB Rabbit Polyclonal Antibody (orb325853)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry