Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

KRT8 Rabbit Polyclonal Antibody

SKU: orb578310

Description

KRT8 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of KRT8. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human KRT8. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Yeast. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Disease Biomarkers

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rat, Yeast

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human KRT8
TargetKRT8
Protein SequenceSynthetic peptide located within the following region: MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL
Molecular Weight53kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

K8, KO, CK8, CK-8, CYK8, K2C8, CARD2

Similar Products

  • Cytokeratin 8/KRT8 Rabbit Polyclonal Antibody [orb19070]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Cytokeratin 8 Rabbit Polyclonal Antibody [orb10413]

    ELISA,  IF,  IHC-Fr,  IHC-P

    Gallus, Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • KRT8 Rabbit Polyclonal Antibody [orb578311]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • KRT8 Antibody [orb350880]

    ELISA,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • Cytokeratin 8 rabbit pAb Antibody [orb765010]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

KRT8 Rabbit Polyclonal Antibody

KRT8 Antibody (orb578310), Catalog Number: orb578310, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm and membrane of hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

KRT8 Rabbit Polyclonal Antibody

Rabbit Anti-KRT8 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

KRT8 Rabbit Polyclonal Antibody

Rabbit Anti-KRT8 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

KRT8 Rabbit Polyclonal Antibody

Sample Type: Human Triple Negative Breast Cancer Xenografts, Primary Dilution: 1:100, Secondary (Anti-Rabbit 594) Dilution: 1:200.

KRT8 Rabbit Polyclonal Antibody

Small intestine

KRT8 Rabbit Polyclonal Antibody

WB Suggested Anti-KRT8 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002264

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

KRT8 Rabbit Polyclonal Antibody (orb578310)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry