Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

LAS1L Rabbit Polyclonal Antibody

SKU: orb324567

Description

LAS1L Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of LAS1L. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Human LAS1L. This antibody reacts with Human samples and is predicted to react with Bovine, Equine. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Equine

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human LAS1L
TargetLAS1L
Protein SequenceSynthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE
Molecular Weight83kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti Las1-like antibody, anti dJ475B7.2 antibody

Similar Products

  • Rabbit LAS1L Antibody [orb1522995]

    IHC,  IP,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • LAS1L Rabbit Polyclonal Antibody [orb324568]

    WB

    Bovine, Equine

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • Rabbit LAS1L Antibody [orb1522997]

    IHC,  IP

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • LAS1L Antibody [orb417583]

    ELISA,  IF,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • LAS1L Rabbit Polyclonal Antibody [orb628380]

    ELISA,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

LAS1L Rabbit Polyclonal Antibody

Sample Type: COLO205, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in COLO205.

LAS1L Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in HeLa.

LAS1L Rabbit Polyclonal Antibody

Sample Type: HT1080, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in HT1080.

LAS1L Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

LAS1L Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

LAS1L Rabbit Polyclonal Antibody

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in Jurkat.

LAS1L Rabbit Polyclonal Antibody

Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in MCF7.

LAS1L Rabbit Polyclonal Antibody

Sample Type: OVCAR-3, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in OVCAR3.

LAS1L Rabbit Polyclonal Antibody

WB Suggested Anti-LAS1L Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_112483

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

LAS1L Rabbit Polyclonal Antibody (orb324567)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry