Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

LDHA Rabbit Polyclonal Antibody

SKU: orb582474

Description

LDHA Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of LDHA. It is suitable for IHC-P, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human LDHA. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LDHA
TargetLDHA
Protein SequenceSynthetic peptide located within the following region: PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH
Molecular Weight37kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

LDHM, GSD11, PIG19, HEL-S-133P

Similar Products

  • LDHA Rabbit Polyclonal Antibody [orb381077]

    FC,  ICC,  IF,  IHC,  KO/KD Validated,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • LDHA Rabbit Polyclonal Antibody [orb582473]

    IHC,  KO/KD Validated,  WB

    Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • LDHA Antibody [orb239997]

    ELISA,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • LDHA Specific Rabbit Polyclonal Antibody [orb395266]

    ELISA,  FC,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • LDHA Rabbit Polyclonal Antibody [orb628406]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

LDHA Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat, MCF7, 721_B, Antibody dilution: 1.0 ug/ml.

LDHA Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. LDHA is supported by BioGPS gene expression data to be expressed in HeLa.

LDHA Rabbit Polyclonal Antibody

LDHA was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb582474 with 1:200 dilution. Western blot was performed using orb582474 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: LDHA IP with orb582474 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

LDHA Rabbit Polyclonal Antibody

Rabbit Anti-LDHA Antibody, Catalog Number: orb582474, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

LDHA Rabbit Polyclonal Antibody

WB Suggested Anti-LDHA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005557

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

LDHA Rabbit Polyclonal Antibody (orb582474)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry