FLJ36070 Rabbit Polyclonal Antibody

SKU: orb326039

Description

FLJ36070 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of MAMSTR. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ36070. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ36070
• Target: MAMSTR
• Protein Sequence: Synthetic peptide located within the following region: QPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQQLRLR
• Molecular Weight: 33kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ36070 antibody, anti MASTR antibody, anti MGC117259 antibody

WB Suggested Anti-FLJ36070 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human heart.

Quick Database Links

Gene Symbol

MAMSTR

UniProt

Q6ZN01

RefSeq (Protein):NP_872380