MAP2K7 Rabbit Polyclonal Antibody

SKU: orb325434

Description

MAP2K7 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of MAP2K7. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of Human MP2K7. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MP2K7
• Target: MAP2K7
• Protein Sequence: Synthetic peptide located within the following region: KDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTS
• Molecular Weight: 50kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti MAP2K7 antibody, anti JNKK2 antibody, anti MEK7 antibody, anti MKK7 antibody, anti PRKMK7 antibody, anti SKK4 antibody, anti antibody

Sample Type: 293T Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.

Quick Database Links

Gene Symbol

MAP2K7

UniProt

O14733