Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

MCM4 Rabbit Polyclonal Antibody

SKU: orb576047

Description

MCM4 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of MCM4. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human MCM4. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MCM4
TargetMCM4
Protein SequenceSynthetic peptide located within the following region: VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE
Molecular Weight95kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

NKCD, CDC21, CDC54, IMD54, NKGCD, hCdc21, P1-CDC21

Similar Products

  • MCM4 Rabbit Polyclonal Antibody [orb738454]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • MCM4 Antibody [orb415601]

    ELISA,  IF,  IHC,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • MCM4 Antibody [orb522717]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • MCM4 Antibody [orb1257980]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • MCM4 Rabbit Polyclonal Antibody [orb628696]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

MCM4 Rabbit Polyclonal Antibody

Rabbit Anti-MCM4 Antibody, Catalog Number: orb576047, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

MCM4 Rabbit Polyclonal Antibody

WB Suggested Anti-MCM4 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:12500, Positive Control: Jurkat cell lysate. MCM4 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005905

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

MCM4 Rabbit Polyclonal Antibody (orb576047)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry