Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

MED14 Rabbit Polyclonal Antibody

SKU: orb583889

Description

MED14 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of MED14. It is suitable for ChIP, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human MED14. This antibody reacts with Human samples and is predicted to react with Mouse, Rabbit. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

Tested ApplicationsChIP, WB
ReactivityHuman
Predicted ReactivityMouse, Rabbit

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MED14
TargetMED14
Protein SequenceSynthetic peptide located within the following region: AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE
Molecular Weight161 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CSRP, RGR1, CRSP2, EXLM1, CXorf4, CRSP150, DRIP150, TRAP170

Similar Products

  • MDH2 Rabbit Polyclonal Antibody [orb865430]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • CLASP1 Rabbit Polyclonal Antibody [orb1184727]

    ELISA,  IF,  IHC,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • VDAC3 Rabbit Polyclonal Antibody [orb669212]

    ELISA,  FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • SMC2 Rabbit Polyclonal Antibody [orb1474833]

    ELISA,  FC,  ICC,  IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • SUCLA2 Rabbit Polyclonal Antibody [orb1676262]

    ELISA,  FC,  ICC,  IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

MED14 Rabbit Polyclonal Antibody

WB analysis of orb583889.

MED14 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. In addition to the 161 kDa canonical isoform, a 127 kDa putative isoform is present in some samples.

MED14 Rabbit Polyclonal Antibody

Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

MED14 Rabbit Polyclonal Antibody

WB Suggested Anti-MED14 Antibody Titration: 0.2-1 ug/ml, Positive Control: A549 cell lysate. MED14 is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004220

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
ChIP
Chromatin Immunoprecipitation
View Protocol

MED14 Rabbit Polyclonal Antibody (orb583889)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry