C2orf33 Rabbit Polyclonal Antibody

SKU: orb325479

Description

C2orf33 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of MFF. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf33. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf33
• Target: MFF
• Protein Sequence: Synthetic peptide located within the following region: VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW
• Molecular Weight: 38kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DKFZp666J168 antibody, anti GL004 antibody, anti MGC110913 antibody, anti C2orf33 antibody

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.

Positive control (+): MCF7 (N10), Negative control (-): A549 (N03), Antibody concentration: 1 ug/mL.

WB Suggested Anti-C2orf33 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Muscle.

Quick Database Links

Gene Symbol

MFF

UniProt

Q9GZY8

RefSeq (Protein):NP_064579