Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

MIEF1 Rabbit Polyclonal Antibody

SKU: orb580726

Description

MIEF1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of MIEF1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human SMCR7L. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SMCR7L
TargetMIEF1
Protein SequenceSynthetic peptide located within the following region: GAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLN
Molecular Weight51 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

MID51, SMCR7L, AltMIEF1, HSU79252, MIEF1-MP, dJ1104E15.3

Similar Products

  • MIEF1 Rabbit Polyclonal Antibody [orb745954]

    ELISA,  FC,  ICC,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • MIEF1 Rabbit Polyclonal Antibody [orb631331]

    ELISA,  IF,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • MIEF1 Rabbit Polyclonal Antibody [orb313156]

    WB

    Bovine, Equine, Gallus, Human, Porcine, Rabbit, Rat, Sheep, Zebrafish

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • MIEF1 Antibody [orb355619]

    ELISA,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • mief1 Antibody [orb860460]

    ELISA,  WB

    Fish

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

MIEF1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~16 kDa.

MIEF1 Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

MIEF1 Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

MIEF1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

MIEF1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

MIEF1 Rabbit Polyclonal Antibody

Positive control (+): A549 (N03), Negative control (-): MCF7 (N10), Antibody concentration: 1 ug/ml.

MIEF1 Rabbit Polyclonal Antibody

WB Suggested Anti-SMCR7L Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: HT1080 cell lysate. SMCR7L is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_061881

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

MIEF1 Rabbit Polyclonal Antibody (orb580726)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry