Monkey CCL8 protein

SKU: orb1215683

Description

The Cynomolgus Monkey CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CCL8 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP (77)) (Gene ID: 102137164).

Research Area

Immunology & Inflammation

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Monkey
Target	CCL8
Protein Length	77.0
MW	9.0 kDa
Purity	98%
Protein Sequence	AQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP (77)

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

CCL8

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols