Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

MYC Rabbit Polyclonal Antibody

SKU: orb329569

Description

MYC Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of MYC. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human MYC. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MYC
TargetMYC
Protein SequenceSynthetic peptide located within the following region: QPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGL
Molecular Weight50kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti c-Myc antibody, anti MRTL antibody, anti bHLHe39 antibody

Similar Products

  • LSM5 Rabbit Polyclonal Antibody [orb670312]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • NDUFAF1 Rabbit Polyclonal Antibody [orb865438]

    ELISA,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • ENO1 Rabbit Polyclonal Antibody [orb1145817]

    ELISA,  FC,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • N myc interactor/NMI Rabbit Polyclonal Antibody [orb251523]

    FC,  ICC,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • SHQ1 Rabbit Polyclonal Antibody [orb1402074]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

MYC Rabbit Polyclonal Antibody

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/mL.

MYC Rabbit Polyclonal Antibody

Rabbit Anti-MYC Antibody, Catalog Number: orb329569, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

MYC Rabbit Polyclonal Antibody

WB Suggested Anti-MYC Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HT1080 cell lysate, MYC is supported by BioGPS gene expression data to be expressed in HT1080.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002458

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

MYC Rabbit Polyclonal Antibody (orb329569)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry