Naa60 Rabbit Polyclonal Antibody

SKU: orb325402

Description

Naa60 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Naa60. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Naa60. This antibody reacts with Rat samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Rat
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Naa60
• Target: Naa60
• Protein Sequence: Synthetic peptide located within the following region: IVGMIVAEIKNRTKIHKEDGDILASSFSVDTQVAYILSLGVVKEFRKHGI
• Molecular Weight: 26kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti MGC124897 antibody, anti RGD1308915 antibody

WB Suggested Anti-Naa60 Antibody, Titration: 1.0 ug/mL, Positive Control: Rat Heart.

Quick Database Links

Gene Symbol

Naa60

UniProt

Q3MHC1

RefSeq (Protein):NP_001014248