Nme1 Rabbit Polyclonal Antibody

SKU: orb576557

Description

Nme1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting Nme1. It is suitable for DOT, WB and is reactive with human, mouse samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Yeast. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: DOT, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: Nme1
• Protein Sequence: Synthetic peptide located within the following region: NVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEIS
• Molecular Weight: 17kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

NDP, NM23A, NDPK-A, NM23-M, NM23-M1, AL024257

DB Suggested Anti-Nme1 antibody, Titration: 0.5 ug/ml, Positive Control: Recomninant human NME2 protein.

Lanes: 1. 20 ug human MDA-MB-231 cell lysate, 2. 20 ug murine 4T1 primary breast tumor cell lysate, 3. 20 ug human MDA-MB-231 cell lysate, 4. 20 ug murine 4T1 primary breast tumor cell lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody Dilution: 1:25000, Gene Name: Nme1.

WB Suggested Anti-Nme1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Liver.

Quick Database Links

Gene Symbol

Nme1

UniProt

P15532

RefSeq (Protein):NP_032730