NOCT Rabbit Polyclonal Antibody

SKU: orb574256

Description

NOCT Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of NOCT. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human CCRN4L. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCRN4L
• Target: NOCT
• Protein Sequence: Synthetic peptide located within the following region: LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD
• Molecular Weight: 48kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

NOC, CCR4L, Ccr4c, CCRN4L

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. The canonical 48 kDa protein is processed to 40 kDa.

Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Ovary Tumor (T-OV), Antibody concentration: 3 ug/ml.

Human Lung

Rabbit Anti-CCRN4L antibody, Paraffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-CCRN4L Antibody Titration: 1.0-2.0 ug/ml, Positive Control: Daudi cell lysate, CCRN4L is supported by BioGPS gene expression data to be expressed in Daudi.

Quick Database Links

Gene Symbol

NOCT

UniProt

Q9UK39

RefSeq (Protein):NP_036250