You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CCRN4L |
| Target | NOCT |
| Protein Sequence | Synthetic peptide located within the following region: LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD |
| Molecular Weight | 48kDa |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−NOCT Rabbit Polyclonal Antibody [orb158009]
ELISA, WB
Mouse, Rat
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
NOCT rabbit pAb Antibody [orb771936]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
NOCT Polyclonal Antibody [orb616773]
WB
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
NOCT Polyclonal Conjugated Antibody [orb1627391]
Mouse, Rat
Rabbit
Polyclonal
Biotin

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment. The canonical 48 kDa protein is processed to 40 kDa.

Positive control (+): 293T Cell Lysate (2T), Negative control (-): Human Ovary Tumor (T-OV), Antibody concentration: 3 ug/ml.

Human Lung

Rabbit Anti-CCRN4L antibody, Paraffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-CCRN4L Antibody Titration: 1.0-2.0 ug/ml, Positive Control: Daudi cell lysate, CCRN4L is supported by BioGPS gene expression data to be expressed in Daudi.
Documents Download
Request a Document
Protocol Information
NOCT Rabbit Polyclonal Antibody (orb574256)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

