Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

NOS2 Rabbit Polyclonal Antibody

SKU: orb585494

Description

NOS2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting NOS2. It is suitable for IHC, WB and is reactive with human samples. Predicted reactivity includes Human. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityHuman

Key Properties

HostRabbit
ClonalityPolyclonal
TargetNOS2
Protein SequenceSynthetic peptide located within the following region: PCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSS
Molecular Weight110kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

NOS, INOS, NOS2A, HEP-NOS

Similar Products

  • NFKB p65 Rabbit Polyclonal Antibody [orb11118]

    FC,  ICC

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Rat, Sheep, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • NFKB p65 Rabbit Polyclonal Antibody [orb312399]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  KO/KD Validated,  WB

    Bovine, Canine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • iNOS Rabbit Polyclonal Antibody [orb13614]

    IHC-P,  WB

    Rabbit

    Polyclonal

    Unconjugated

  • Phospho-NFKB p65 (Ser468) Rabbit Polyclonal Antibody [orb6503]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Phospho-NFKB p65 (Ser536) Rabbit Polyclonal Antibody [orb6504]

    WB

    Human, Monkey, Rat

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

NOS2 Rabbit Polyclonal Antibody

Lanes: Lane 1: 30 ug human placental tissue lysate, Lane 2: 30 ug human placental tissue lysate, Lane 3: 30 ug human placental tissue lysate, Lane 4: 30 ug human placental tissue lysate, Lane 5: 20 ug human myometrial tissue lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: Nitric oxide synthase 2, inducible (NOS2).

NOS2 Rabbit Polyclonal Antibody

Rabbit Anti-NOS2 Antibody, Catalog Number: orb585494, Formalin Fixed Paraffin Embedded Tissue: Human Appendix (Colon) Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

NOS2 Rabbit Polyclonal Antibody

Application: Western blotting, Species+tissue/cell type: Human placental and myometrial tissue lysate, How many ug'sof tissue/cell lysate run on the gel: 1: 50 ug human placental tissue lysate, 2: 40 ug human placental tissue lysate, 3: 30 ug human placental tissue lysate, 4: 20 ug human placental tissue lysate, 5: 10 ug human placental tissue lysate, 6: 20 ug human myometrial tissue lysate, Primary antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit HRP, Secondary antibody dilution: 1:10000.

NOS2 Rabbit Polyclonal Antibody

Sample Type: Human placental tissue, Primary Antibody dilution: 1:50, Secondary Antibody: Goat anti rabbit-HRP, Secondary Antibody dilution: 1:10000, Color/Signal Descriptions: Brown: NOS2 Purple: Haemotoxylin, Gene Name: NOS2.

NOS2 Rabbit Polyclonal Antibody

WB Suggested Anti-NOS2 Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
RefSeqEAW51048

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

NOS2 Rabbit Polyclonal Antibody (orb585494)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry