Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

NT5E Rabbit Polyclonal Antibody

SKU: orb326519

Description

NT5E Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting NT5E. It is suitable for WB and is reactive with human, rat samples. Predicted reactivity includes Bovine, Canine, Equine, Mouse, Porcine, Rabbit. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Mouse, Porcine, Rabbit

Key Properties

HostRabbit
ClonalityPolyclonal
TargetNT5E
Protein SequenceSynthetic peptide located within the following region: KAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCRVP
Molecular Weight63 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CD73 antibody, anti E5NT antibody, anti NT antibody, anti NT5 antibody, anti NTE antibody, anti eN antibody, anti eNT antibody

Similar Products

  • CD73 Rabbit Polyclonal Antibody [orb2931]

    FC

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • CD73 rabbit pAb Antibody [orb766859]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • CD73/Nt5e Rabbit Polyclonal Antibody [orb654448]

    ELISA,  FC,  IHC,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • NT5E Antibody [orb520242]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • NT5E Antibody [orb1258329]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

NT5E Rabbit Polyclonal Antibody

25 ug of the indicated Mouse and Rat tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recognizes both the 63 kDa preprotein as well as the processed 57 kDa mature form of these proteins.

NT5E Rabbit Polyclonal Antibody

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

NT5E Rabbit Polyclonal Antibody

WB Suggested Anti-NT5E Antibody, Titration: 1.0 ug/mL, Positive Control: 721_B Whole Cell.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002517

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

NT5E Rabbit Polyclonal Antibody (orb326519)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry