Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

OGT Rabbit Polyclonal Antibody

SKU: orb330577

Description

OGT Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of OGT. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human OGT. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human OGT
TargetOGT
Protein SequenceSynthetic peptide located within the following region: ASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE
Molecular Weight117kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti FLJ23071 antibody, anti HRNT1 antibody, anti MGC22921 antibody, anti O-GLCNAC antibody

Similar Products

  • OGT/O-Linked N-Acetylglucosamine Transferase Rabbit Polyclonal Antibody [orb334499]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • TRAK1 Rabbit Polyclonal Antibody [orb4795]

    ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • OGT Antibody [orb243357]

    ELISA,  IF,  IHC

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • OGT Rabbit Polyclonal Antibody [orb340807]

    IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • OGT Rabbit Polyclonal Antibody [orb629521]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

OGT Rabbit Polyclonal Antibody

Sample Type: 721_B Whole Cell lysates, Antibody dilution: 1.0 ug/ml. OGT is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

OGT Rabbit Polyclonal Antibody

Rabbit Anti-OGT Antibody, Catalog Number: orb330577, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic in processes of pinealocytes and endothelial cells in blood vessels, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_858058

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

OGT Rabbit Polyclonal Antibody (orb330577)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry