OXT Rabbit Polyclonal Antibody

SKU: orb330205

Description

OXT Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting OXT. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cardiovascular Research

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: OXT
• Protein Sequence: Synthetic peptide located within the following region: LGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCA
• Molecular Weight: 9kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti MGC126890 antibody, anti MGC126892 antibody, anti OT antibody, anti OT-NPI antibody

Sample Tissue: Human Jurkat, Antibody Dilution: 1 ug/mL.

Quick Database Links

Gene Symbol

OXT

UniProt

P01178

RefSeq (Protein):NP_000906