P4HA1 Rabbit Polyclonal Antibody

SKU: orb331162

Description

P4HA1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting P4HA1. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Bovine, Canine, Equine, Mouse, Porcine, Rat. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: P4HA1
• Protein Sequence: Synthetic peptide located within the following region: TKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKG
• Molecular Weight: 59kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti P4HA antibody

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-P4HA1 Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell, P4HA1 is supported by BioGPS gene expression data to be expressed in HEK293T.

Quick Database Links

Gene Symbol

P4HA1

UniProt

P13674

RefSeq (Protein):NP_000908