Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

Description

Defensin like peptide with potent antiviral activity; Antimicrobial peptides.

Research Area

Infectious Disease & Virology

Images & Validation

Key Properties

MW3412.1 Da
Purity> 95% by HPLC
FormulaC144H232N52O35S5
Protein SequenceH-Asn-Gly-Ala-Ile-Cys-Trp-Gly-Pro-Cys-Pro-Thr-Ala-Phe-Arg-Gln-Ile-Gly-Asn-Cys-Gly-Arg-Phe-Arg-Val-Arg-Cys-Cys-Arg-Ile-Arg-OH

Storage & Handling

StorageStore dry, frozen and in the dark
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

MERS-CoV CV060, NGAICWGPCPTAFRQIGNCGRFRVRCCRIR, P9R, SARS-CoV, SARS-CoV-2, antiviral activity, avian influenza, coronavirus, defensin, peptide, rhinovirus
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

P9R (orb1140591)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

1 mg
$ 390.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry