Pax8 Rabbit Polyclonal Antibody

SKU: orb574974

Description

Pax8 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting Pax8. It is suitable for IHC, WB and is reactive with human, mouse samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: Pax8
• Protein Sequence: Synthetic peptide located within the following region: PPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASS
• Molecular Weight: 49kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Pax, Pax-8

Rabbit Anti-PAX8 Antibody, Catalog Number: orb574974, Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Tissue, Observed Staining: Nucleus in follicular cells, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-Pax8 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Pancreas.

Quick Database Links

Gene Symbol

Pax8

UniProt

Q00288

RefSeq (Protein):NP_035170