Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PCBP1 Rabbit Polyclonal Antibody

SKU: orb330139

Description

PCBP1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PCBP1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of Human PCBP1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Infectious Disease & Virology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human PCBP1
TargetPCBP1
Protein SequenceSynthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF
Molecular Weight37 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti HNRPE1 antibody, anti HNRPX antibody, anti hnRNP-E1 antibody, anti hnRNP-X antibody

Similar Products

  • PCBP1 Rabbit Polyclonal Antibody [orb692204]

    ELISA,  FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • PCBP1 Rabbit Polyclonal Antibody [orb330138]

    WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • PCBP1 Rabbit Polyclonal Antibody [orb395147]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • PCBP1 rabbit pAb Antibody [orb771939]

    ELISA,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

  • PCBP1 Rabbit Polyclonal Antibody (PE) [orb489818]

    ICC,  IF

    Bovine, Equine, Human, Mouse, Porcine

    Rabbit

    Polyclonal

    PE

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

PCBP1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. A second isoform of 33 kDa also contains the peptide, and the protein is phosphorylated.

PCBP1 Rabbit Polyclonal Antibody

Anti-PCBP1 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

PCBP1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL.

PCBP1 Rabbit Polyclonal Antibody

Sample Tissue: Human HCT116, Antibody Dilution: 1.0 ug/mL.

PCBP1 Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

PCBP1 Rabbit Polyclonal Antibody

Sample Type: MCF7 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL, PCBP1 is supported by BioGPS gene expression data to be expressed in MCF7.

PCBP1 Rabbit Polyclonal Antibody

Rabbit Anti-PCBP1 Antibody, Paraffin Embedded Tissue: Human Breast, Antibody Concentration: 5 ug/mL.

PCBP1 Rabbit Polyclonal Antibody

Rabbit Anti-PCBP1 Antibody, Paraffin Embedded Tissue: Human Breast, Antibody Concentration: 5 ug/mL.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006187

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

PCBP1 Rabbit Polyclonal Antibody (orb330139)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry