Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PDE9A Rabbit Polyclonal Antibody

SKU: orb579570

Description

PDE9A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PDE9A. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human PDE9A. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PDE9A
TargetPDE9A
Protein SequenceSynthetic peptide located within the following region: SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPET
Molecular Weight61kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HSPDE9A2

Similar Products

  • PDE9A Antibody [orb417047]

    ELISA,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • PDE9A Rabbit Polyclonal Antibody [orb629767]

    ELISA,  IF,  IHC

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • PDE9A Rabbit Polyclonal Antibody [orb312711]

    IF,  IHC-Fr,  IHC-P

    Bovine, Human, Porcine, Rat, Sheep

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • PDE9A Antibody [orb1534429]

    IHC,  IHC-P

    Canine, Human, Monkey

    Rabbit

    Polyclonal

    Unconjugated

  • Pde9a Antibody [orb864160]

    ELISA,  WB

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

PDE9A Rabbit Polyclonal Antibody

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

PDE9A Rabbit Polyclonal Antibody

Human kidney

PDE9A Rabbit Polyclonal Antibody

Sample Type: Lane 1: 5 ug in vitro translation without DNA, Lane 2: 5 ug in vitro translation hNeur1-pcDNA3, Lane 3: 60 ug in vitro translation rNeur1-pcDNA3, Lane 4: 60 ug HEK293 cell lysate (not transfected), Lane 5: 60 ug hNeur1-pcDNA3 overexpressed in HEK293 cells, Lane 6: 60 ug rNeur1-pcDNA3 overexpressed in HEK293 cells. Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Color/Signal Descriptions: PDE9A.

PDE9A Rabbit Polyclonal Antibody

WB Suggested Anti-PDE9A Antibody Titration: 1.0 ug/ml, Positive Control: Jurkat cell lysate.

PDE9A Rabbit Polyclonal Antibody

WB Suggested Anti-PDE9A Antibody Titration: 5% Milk, ELISA Titer: dilution: 1:500, Positive Control: Mouse Brain lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

PDE9A Rabbit Polyclonal Antibody (orb579570)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry