Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PDYN Rabbit Polyclonal Antibody

SKU: orb330935

Description

PDYN Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PDYN. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human PDYN. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PDYN
TargetPDYN
Protein SequenceSynthetic peptide located within the following region: SELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGE
Molecular Weight27kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti MGC26418 antibody, anti PENKB antibody, anti ADCA antibody, anti SCA23 antibody

Similar Products

  • Beta neoendorphin Rabbit Polyclonal Antibody [orb182460]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Big dynorphin Rabbit Polyclonal Antibody [orb182450]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • PDYN rabbit pAb Antibody [orb774306]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • Alpha neoendorphin Rabbit Polyclonal Antibody [orb182424]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • PDYN antibody [orb74170]

    IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

PDYN Rabbit Polyclonal Antibody

Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 3 ug/ml.

PDYN Rabbit Polyclonal Antibody

Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.

PDYN Rabbit Polyclonal Antibody

WB Suggested Anti-PDYN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_077722

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PDYN Rabbit Polyclonal Antibody (orb330935)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry