PIGZ Rabbit Polyclonal Antibody

SKU: orb324926

Description

PIGZ Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PIGZ. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human PIGZ. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIGZ
• Target: PIGZ
• Protein Sequence: Synthetic peptide located within the following region: VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY
• Molecular Weight: 63kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ12768 antibody, anti GPI-MT-IV antibody, anti MGC52163 antibody, anti SMP3 antibody, anti PIG-Z antibody

WB Suggested Anti-PIGZ Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.

Quick Database Links

Gene Symbol

PIGZ

UniProt

Q86VD9

RefSeq (Protein):NP_079439