Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PINK1 Rabbit Polyclonal Antibody

SKU: orb331223

Description

PINK1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PINK1. It is suitable for IHC, WB applications. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Equine, Guinea pig, Mouse, Rabbit, Rat
Application Notes
Predicted Homology Based on Immunogen Sequence Cow: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%.

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenSynthetic peptide located within the following region: GCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSACQEIQAIFTQKSKPGP
TargetPINK1
Protein SequenceSynthetic peptide located within the following region: GCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSACQEIQAIFTQKSKPGP
Molecular Weight63 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti BRPK antibody, anti FLJ27236 antibody, anti PARK6 antibody

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

PINK1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

PINK1 Rabbit Polyclonal Antibody

Rabbit Anti-PINK1 Antibody, Catalog Number: orb331223, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

PINK1 Rabbit Polyclonal Antibody

Rabbit Anti-PINK1 Antibody, Catalog Number: orb331223, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

PINK1 Rabbit Polyclonal Antibody

WB Suggested Anti-PINK1 Antibody, Titration: 1.0 ug/ml, Positive Control: RPMI-8226 Whole Cell.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_115785

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

Filter by Applications

Filter by Species

Nabila Bourebaba 1, Justyna Domagała 2, Lynda Bourebaba 3 Revitalizing equine metabolism: how SHBG improves mitochondrial function and reduces inflammation BMC Vet Res, (2025)

Applications

WB

Reactivity

Equine

PINK1 Rabbit Polyclonal Antibody (orb331223)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry