Pkn2 Rabbit Polyclonal Antibody

SKU: orb585153

Description

Pkn2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Pkn2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Pkn2. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Pkn2
• Target: Pkn2
• Protein Sequence: Synthetic peptide located within the following region: LRRNPERRLGAGEKDAEDVKKHPFFRLTDWSALMDKKVKPPFVPTIRGRE
• Molecular Weight: 111kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PR, Prk, Stk, PRK2, Stk7, Prkcl2, AI507382, 6030436C20Rik

Sample Type: Mouse Thymus lysates, Antibody dilution: 1.0 ug/ml.

Quick Database Links

Gene Symbol

Pkn2

UniProt

Q8BWW9

RefSeq (Protein):NP_848769