Ppargc1a Rabbit Polyclonal Antibody

SKU: orb330094

Description

Ppargc1a Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Ppargc1a. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of mouse Ppargc1a. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

−

Item 1 of 2

Tested Applications	WB
Reactivity	Mouse
Predicted Reactivity	Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Sheep

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of mouse Ppargc1a
Target	Ppargc1a
Protein Sequence	Synthetic peptide located within the following region: QEIRAELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFSKLPVFINSGL
Molecular Weight	90kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti A830037N07Rik antibody, anti PGC-1 antibody, anti PGC-1v antibody, anti Pgc-1alpha antibody, anti Pgc1 antibody, anti Pgco1 antibody, anti Ppargc1 antibody, anti Gm11133 antibody, anti ENSMUSG00000079510 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Ppargc1a antibody - middle region (orb330094) validated by WB using Transfected Melanoma Cell at 1:1000.

WB Suggested Anti-Ppargc1a Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.

Quick Database Links

Gene Symbol

Ppargc1a

UniProt

O70343

RefSeq (Protein):NP_032930

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_032930

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols