Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PPP1R13L Rabbit Polyclonal Antibody

SKU: orb329694

Description

PPP1R13L Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PPP1R13L. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human PPP1R13L. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PPP1R13L
TargetPPP1R13L
Protein SequenceSynthetic peptide located within the following region: AQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRL
Molecular Weight89kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti IASPP antibody, anti NKIP1 antibody, anti RAI antibody, anti iASPP gene antibody, anti RAI4 antibody

Similar Products

  • IASPP Rabbit Polyclonal Antibody [orb10862]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Guinea pig, Mouse, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • PPP1R13L Rabbit Polyclonal Antibody [orb630144]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • PPP1R13L Antibody [orb522595]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • PPP1R13L Antibody [orb522596]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • PPP1R13L Rabbit Polyclonal Antibody [orb630145]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

PPP1R13L Rabbit Polyclonal Antibody

Lanes: 1. 30 ug MiaPaca-2 cell lysate, 2. 30 ug Panc-1 cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary Antibody Dilution: 1:4000, Gene Name: PPP1R13L.

PPP1R13L Rabbit Polyclonal Antibody

Sample Type: Human lung adenocarcinoma cell line A549, Primary Antibody Dilution: 1:100, Secondary Antibody: Goat anti-rabbit AlexaFluor 488, Secondary Antibody Dilution: 1:400, Color/Signal Descriptions: PPP1R13L: Green DAPI:Blue, Gene Name: PPP1R13L.

PPP1R13L Rabbit Polyclonal Antibody

WB Suggested Anti-PPP1R13L Antibody Titration: 0.2-1 ug/mL, Positive Control: Transfected 293T.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006654

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

PPP1R13L Rabbit Polyclonal Antibody (orb329694)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry