PPP2R3A Rabbit Polyclonal Antibody

SKU: orb330843

Description

PPP2R3A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of PPP2R3A. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R3A. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R3A
• Target: PPP2R3A
• Protein Sequence: Synthetic peptide located within the following region: SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD
• Molecular Weight: 130kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti PPP2R3 antibody, anti PR130 antibody, anti PR72 antibody

Immunohistochemistry with Placenta tissue at an antibody concentration of 5 ug/ml using anti-PPP2R3A antibody (orb330843).

WB Suggested Anti-PPP2R3A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.

Quick Database Links

Gene Symbol

PPP2R3A

UniProt

Q06190

RefSeq (Protein):NP_002709